Imgflip Logo Icon

This Just Made Me Smile !

216 views • 14 upvotes • Made by SardineYoghurt 2 months ago in Everyones_A_Mod
gifsflyingwalkingswimmingdancingduck
Make your own GIF
8 Comments
TheMemeLover490261 M
1 up, 2mo,
2 replies
Whitty becomes angry | THE WOLF THE FISH THE DOG THE DUCK | image tagged in whitty becomes angry | made w/ Imgflip meme maker
TheMemeLover490261 M
1 up, 2mo
*Birb
SardineYoghurt M
0 ups, 2mo
That's a very strange and disturbing sequence ! :~)
Gadge888 M
1 up, 2mo,
1 reply
Leo pointing | HE DANCES TOO, AND GOES WELL WITH HOISIN SAUCE | image tagged in leo pointing | made w/ Imgflip meme maker
SardineYoghurt M
1 up, 2mo,
1 reply
Does the sauce apply to the other creatures ?
Gadge888 M
1 up, 2mo,
1 reply
cat scientist | YOU KNOW, I'M NOT SURE. LET ME EXPERIMENT. THE DOG CAN GO FIRST | image tagged in cat scientist | made w/ Imgflip meme maker
SardineYoghurt M
1 up, 2mo,
1 reply
Let us all know the result !
FireworkDavidStevens. M
1 up, 2mo
Ok, mods
Make your own GIF
Created from video with the Imgflip Animated GIF Maker